genetics Watch

naron123
Badges: 0
Rep:
?
#1
Report Thread starter 1 year ago
#1
1. From the information given on the amino acid sequence determine where within the DNA sequence the dinosaur gene starts (i.e. the first three bases that will be translated into the protein).Then complete the table below for the first 5 amino acids at the NH2- terminal end of the dinosaur protein:

Non-template DNA sequence of
dinosaur gene

Template DNA sequence of gene
mRNA sequence arising

Amino acid incorporated into
dinosaur protein
Give both 3 letter and one letter codes

Dinosaur gene DNA sequence (non-template strand)
1 gaattccgac cgcggtgaca cacggctgca ggcccccccc atggagttcg tggcgctggg
61 ggggccggat gcgggctccc ccactccgtt ccctgatgaa gccggagcct tcctggggct
121 gggggggggc gagaggacgg aggcgggggg gctgctggcc tcctaccccc cctcaggccg
181 cgtgtccctg gtgccgtggg cagacacggg tactttgggg accccccagt gggtgccgcc
241 cgccacccaa atggagcccc cccactacct ggagctgctg caaccccccc ggggcagccc
301 cccccatccc tcctccgggc ccctactgcc actcagcagc gggcccccac cctgcgaggc
361 ccgtgagtgc gtcaactgcg gagcgacggc aacgccgctg tggcgccggg acggcaccgg
421 gcattacctg tgcaacgcct gcgggctcta ccaccgcctc aacggccaga accgcccgct
481 catccgcccc aaaaagcgcc tgctggtgag taagcgcgca ggcacagtgt gcagcaactg
541 ccagacatcc accaccactc tgtggcgtcg cagccccatg ggggaccccg tctgcaacgc
601 ctgcggcctc tactacaaac tgcaccaagt gaaccgcccc ctcacgatgc gcaaagacgg
661 aatccaaacc cgaaaccgca aagtttcctc caagggtaaa aagcggcgcc ccccgggggg
721 gggaaacccc tccgccaccg cgggaggggg cgctcctatg gggggagggg gggacccctc
781 tatgcccccc ccgccgcccc ccccggccgc cgccccccct caaagcgacg ctctgtacgc
841 tctcggcccc gtggtccttt cgggccattt tctgcccttt ggaaactccg gagggttttt
901 tggggggggg gcggggggtt acacggcccc cccggggctg agcccgcaga tttgagtttg
961 ggggggggaa agggaagggg ggggggcgga tgggattaaa tttttatatg tgaaatggag
1021 cggaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aggaattc

Dinosaur gene amino acid sequence
/translation="MEFVALGGPDAGSPTPFPD EAGAFLGLGGGERTEAGGLLASYPP SGRVSLVPWADTGTLGTPQWVPPATQMEPPHY LELLQPPRGSPPHPSSGPLLPLSSGP PPCEARECVNCGATATPLWRRDGTGHYLCNAC GLYHRLNGQNRPLIRPKKRLLVSKRA GTVCSNCQTSTTTLWRRSPMGDPVCNACGLYY KLHQVNRPLTMRKDGIQTRNRKVSSK GKKRRPPGGGNPSATAGGGAPMGGGGDPSMPP PPPPPAAAPPQSDALYALGPVVLSGH
FLPFGNSGGFFGGGAGGYTAPPGLSPQI"


any help would be appreciated, thank youuu :
0
reply
Asklepios
  • Study Helper
Badges: 19
Rep:
?
#2
Report 1 year ago
#2
(Original post by naron123)
1. From the information given on the amino acid sequence determine where within the DNA sequence the dinosaur gene starts (i.e. the first three bases that will be translated into the protein).Then complete the table below for the first 5 amino acids at the NH2- terminal end of the dinosaur protein:

Non-template DNA sequence of
dinosaur gene

Template DNA sequence of gene
mRNA sequence arising

Amino acid incorporated into
dinosaur protein
Give both 3 letter and one letter codes

Dinosaur gene DNA sequence (non-template strand)
1 gaattccgac cgcggtgaca cacggctgca ggcccccccc atggagttcg tggcgctggg
61 ggggccggat gcgggctccc ccactccgtt ccctgatgaa gccggagcct tcctggggct
121 gggggggggc gagaggacgg aggcgggggg gctgctggcc tcctaccccc cctcaggccg
181 cgtgtccctg gtgccgtggg cagacacggg tactttgggg accccccagt gggtgccgcc
241 cgccacccaa atggagcccc cccactacct ggagctgctg caaccccccc ggggcagccc
301 cccccatccc tcctccgggc ccctactgcc actcagcagc gggcccccac cctgcgaggc
361 ccgtgagtgc gtcaactgcg gagcgacggc aacgccgctg tggcgccggg acggcaccgg
421 gcattacctg tgcaacgcct gcgggctcta ccaccgcctc aacggccaga accgcccgct
481 catccgcccc aaaaagcgcc tgctggtgag taagcgcgca ggcacagtgt gcagcaactg
541 ccagacatcc accaccactc tgtggcgtcg cagccccatg ggggaccccg tctgcaacgc
601 ctgcggcctc tactacaaac tgcaccaagt gaaccgcccc ctcacgatgc gcaaagacgg
661 aatccaaacc cgaaaccgca aagtttcctc caagggtaaa aagcggcgcc ccccgggggg
721 gggaaacccc tccgccaccg cgggaggggg cgctcctatg gggggagggg gggacccctc
781 tatgcccccc ccgccgcccc ccccggccgc cgccccccct caaagcgacg ctctgtacgc
841 tctcggcccc gtggtccttt cgggccattt tctgcccttt ggaaactccg gagggttttt
901 tggggggggg gcggggggtt acacggcccc cccggggctg agcccgcaga tttgagtttg
961 ggggggggaa agggaagggg ggggggcgga tgggattaaa tttttatatg tgaaatggag
1021 cggaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aggaattc

Dinosaur gene amino acid sequence
/translation="MEFVALGGPDAGSPTPFPD EAGAFLGLGGGERTEAGGLLASYPP SGRVSLVPWADTGTLGTPQWVPPATQMEPPHY LELLQPPRGSPPHPSSGPLLPLSSGP PPCEARECVNCGATATPLWRRDGTGHYLCNAC GLYHRLNGQNRPLIRPKKRLLVSKRA GTVCSNCQTSTTTLWRRSPMGDPVCNACGLYY KLHQVNRPLTMRKDGIQTRNRKVSSK GKKRRPPGGGNPSATAGGGAPMGGGGDPSMPP PPPPPAAAPPQSDALYALGPVVLSGH
FLPFGNSGGFFGGGAGGYTAPPGLSPQI"


any help would be appreciated, thank youuu :
Remember translation always starts at AUG which codes for methionine
1
reply
X

Quick Reply

Attached files
Write a reply...
Reply
new posts
Latest
My Feed

See more of what you like on
The Student Room

You can personalise what you see on TSR. Tell us a little about yourself to get started.

Personalise

University open days

  • Solent University
    Postgraduate and Professional Open Evenings Postgraduate
    Mon, 25 Mar '19
  • Cardiff University
    Undergraduate Open Day Undergraduate
    Wed, 27 Mar '19
  • University of Portsmouth
    Postgraduate and Part-Time Open Evenings Postgraduate
    Wed, 27 Mar '19

Where do you need more help?

Which Uni should I go to? (164)
18.55%
How successful will I become if I take my planned subjects? (88)
9.95%
How happy will I be if I take this career? (147)
16.63%
How do I achieve my dream Uni placement? (127)
14.37%
What should I study to achieve my dream career? (85)
9.62%
How can I be the best version of myself? (273)
30.88%

Watched Threads

View All